Acyl-CoA Binding Domain Containing 5 (ACBD5) (C-Term) Antikörper

Details zu Produkt Nr. ABIN635305
Antigen
Epitop
C-Term
4
3
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
30
21
20
4
3
3
3
2
2
2
1
1
Wirt
Kaninchen
29
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
20
10
3
2
1
Optionen
Immunogen ACBD5 antibody was raised using the C terminal of ACBD5 corresponding to a region with amino acids VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR
Spezifität ACBD5 antibody was raised against the C terminal of ACBD5
Reinigung Affinity purified
Antigen
Andere Bezeichnung ACBD5 (ACBD5 Antibody Abstract)
Hintergrund ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.
Molekulargewicht 55 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ACBD5 Blocking Peptide, catalog no. 33R-9785, is also available for use as a blocking control in assays to test for specificity of this ACBD5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Acyl-CoA Binding Domain Containing 5 (ACBD5) (C-Term) antibody (ABIN635305) ACBD5 antibody used at 1 ug/ml to detect target protein.