FAM3C Antikörper (C-Term)

Produktnummer ABIN635303

Der Kaninchen Polyklonal anti-FAM3C Antikörper wird verwendet zum Nachweis von FAM3C in Proben von Human und Ratte. Er wurde validiert für WB.

Kurzübersicht für FAM3C Antikörper (C-Term) (ABIN635303)

Target: FAM3C (Family with Sequence Similarity 3, Member C (FAM3C))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM3C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM3C Antikörper

Bindungsspezifität: C-Term

Spezifität: FAM3 C antibody was raised against the C terminal of FAM3

Aufreinigung: Affinity purified

Immunogen: FAM3 C antibody was raised using the C terminal of FAM3 corresponding to a region with amino acids DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM3C Blocking Peptide, (ABIN937477), is also available for use as a blocking control in assays to test for specificity of this FAM3C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM3C

Target: FAM3C (Family with Sequence Similarity 3, Member C (FAM3C))

Andere Bezeichnung: FAM3C

Hintergrund: FAM3C is a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.

Molekulargewicht: 22 kDa (MW of target protein)