SLC44A3 Antikörper (Middle Region)

Produktnummer ABIN635296

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch SLC44A3 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SLC44A3 Antikörper (Middle Region) (ABIN635296)

Target: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC44A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC44A3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC44 A3 antibody was raised against the middle region of SLC44 3

Aufreinigung: Affinity purified

Immunogen: SLC44 A3 antibody was raised using the middle region of SLC44 3 corresponding to a region with amino acids TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC44A3 Blocking Peptide, (ABIN5616258), is also available for use as a blocking control in assays to test for specificity of this SLC44A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC44A3

Target: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Andere Bezeichnung: SLC44A3

Hintergrund: SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.

Molekulargewicht: 68 kDa (MW of target protein)