ABCC11 Antikörper

Produktnummer ABIN635292

Der Kaninchen Polyklonal anti-ABCC11 Antikörper (ABIN635292) detektiert spezifisch ABCC11 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ABCC11 Antikörper (ABIN635292)

Target: ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCC11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABCC11 Antikörper

Aufreinigung: Affinity purified

Immunogen: ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCC11 Blocking Peptide, (ABIN5611858), is also available for use as a blocking control in assays to test for specificity of this ABCC11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCC11

Target: ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))

Andere Bezeichnung: ABCC11

Hintergrund: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Molekulargewicht: 154 kDa (MW of target protein)