ABCA5 Antikörper (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5)

Details for Product anti-ABCA5 Antibody No. ABIN635291
Antigen
Reaktivität
Human
47
27
24
4
3
2
1
1
Wirt
Kaninchen
42
7
Klonalität
Polyklonal
Konjugat
Dieser ABCA5 Antikörper ist unkonjugiert
3
2
2
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
32
20
18
8
2
1
1
Optionen
Immunogen ABCA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI
Reinigung Affinity purified
Antigen
Andere Bezeichnung ABCA5 (ABCA5 Antibody Abstract)
Hintergrund The membrane-associated protein ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily.
Molekulargewicht 186 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ABCA5 Blocking Peptide, catalog no. 33R-3759, is also available for use as a blocking control in assays to test for specificity of this ABCA5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCA5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5) antibody (ABIN635291) ABCA5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Mag...
Image no. 2 for anti-ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5) antibody (ABIN635291) ABCA5 antibody used at 1 ug/ml to detect target protein.