ABCG5 Antikörper
-
- Target Alle ABCG5 Antikörper anzeigen
- ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCG5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
- Top Product
- Discover our top product ABCG5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABCG5 Blocking Peptide, catalog no. 33R-1706, is also available for use as a blocking control in assays to test for specificity of this ABCG5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCG5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))
- Andere Bezeichnung
- ABCG5 (ABCG5 Produkte)
- Hintergrund
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily.
- Molekulargewicht
- 72 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-