ABCG5 Antikörper (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5)

Details for Product anti-ABCG5 Antibody No. ABIN635285
Antigen
Reaktivität
Human
50
20
19
2
2
2
1
1
Wirt
Kaninchen
46
5
Klonalität
Polyklonal
Konjugat
Dieser ABCG5 Antikörper ist unkonjugiert
3
2
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
28
17
13
8
7
4
1
1
Optionen
Immunogen ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
Reinigung Affinity purified
Antigen
Andere Bezeichnung ABCG5 (ABCG5 Antibody Abstract)
Hintergrund The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily.
Molekulargewicht 72 kDa (MW of target protein)
Pathways Lipid Metabolism
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ABCG5 Blocking Peptide, catalog no. 33R-1706, is also available for use as a blocking control in assays to test for specificity of this ABCG5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCG5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5) antibody (ABIN635285) ABCG5 antibody used at 1 ug/ml to detect target protein.