KTN1 Antikörper

Produktnummer ABIN635282

Produktdetails anti-KTN1 Antikörper

Target: KTN1 (Kinectin 1 (Kinesin Receptor) (KTN1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KTN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Kinectin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Kinectin 1 Blocking Peptide, catalog no. 33R-2373, is also available for use as a blocking control in assays to test for specificity of this Kinectin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KTN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KTN1

Target: KTN1 (Kinectin 1 (Kinesin Receptor) (KTN1))

Andere Bezeichnung: Kinectin 1 (KTN1 Produkte)

Synonyme: cb213 antikoerper, wu:fi20e02 antikoerper, wu:fi27f06 antikoerper, CG1 antikoerper, KNT antikoerper, MU-RMS-40.19 antikoerper, kinectin 1 antikoerper, kinectin antikoerper, kinectin 1 L homeolog antikoerper, Ktn1 antikoerper, ktn1 antikoerper, KTN1 antikoerper, CpipJ_CPIJ006678 antikoerper, CpipJ_CPIJ006680 antikoerper, CpipJ_CPIJ007437 antikoerper, ktn1.L antikoerper

Hintergrund: Various cellular organelles and vesicles are transported along the microtubules in the cytoplasm. Likewise, membrane recycling of the endoplasmic reticulum (ER), Golgi assembly at the microtubule organizing center, and alignment of lysosomes along microtubules are all related processes. The transport of organelles requires a special class of microtubule-associated proteins (MAPs). One of these is the molecular motor kinesin, an ATPase that moves vesicles unidirectionally toward the plus end of the microtubule.

Molekulargewicht: 150 kDa (MW of target protein)