KTN1 Antikörper

Produktnummer ABIN635282

Der Kaninchen Polyklonal Anti-KTN1-Antikörper wurde für WB validiert. Er ist geeignet, KTN1 in Proben von Human und Maus zu detektieren.

Kurzübersicht für KTN1 Antikörper (ABIN635282)

Target: KTN1 (Kinectin 1 (Kinesin Receptor) (KTN1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KTN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KTN1 Antikörper

Aufreinigung: Affinity purified

Immunogen: Kinectin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Kinectin 1 Blocking Peptide, (ABIN937759), is also available for use as a blocking control in assays to test for specificity of this Kinectin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KTN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KTN1

Target: KTN1 (Kinectin 1 (Kinesin Receptor) (KTN1))

Andere Bezeichnung: Kinectin 1

Hintergrund: Various cellular organelles and vesicles are transported along the microtubules in the cytoplasm. Likewise, membrane recycling of the endoplasmic reticulum (ER), Golgi assembly at the microtubule organizing center, and alignment of lysosomes along microtubules are all related processes. The transport of organelles requires a special class of microtubule-associated proteins (MAPs). One of these is the molecular motor kinesin, an ATPase that moves vesicles unidirectionally toward the plus end of the microtubule.

Molekulargewicht: 150 kDa (MW of target protein)