Junctophilin 3 Antikörper (N-Term)

Produktnummer ABIN635279

Der Kaninchen Polyklonal Anti-Junctophilin 3-Antikörper wurde für WB validiert. Er ist geeignet, Junctophilin 3 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Junctophilin 3 Antikörper (N-Term) (ABIN635279)

Target: Junctophilin 3 (JPH3)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Junctophilin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Junctophilin 3 Antikörper

Bindungsspezifität: N-Term

Spezifität: Junctophilin 3 antibody was raised against the N terminal of JPH3

Aufreinigung: Affinity purified

Immunogen: Junctophilin 3 antibody was raised using the N terminal of JPH3 corresponding to a region with amino acids SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Junctophilin 3 Blocking Peptide, (ABIN5614248), is also available for use as a blocking control in assays to test for specificity of this Junctophilin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Junctophilin 3

Target: Junctophilin 3 (JPH3)

Andere Bezeichnung: Junctophilin 3

Hintergrund: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH3 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. CAG/CTG repeat expansions at the Huntington's disease (HD)-like 2 locus have been identified in the gene that encodes JPH3 protein.

Molekulargewicht: 81 kDa (MW of target protein)