LRRN2 Antikörper (Middle Region)
-
- Target Alle LRRN2 Antikörper anzeigen
- LRRN2 (Leucine Rich Repeat Neuronal 2 (LRRN2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRRN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRN2 antibody was raised against the middle region of LRRN2
- Aufreinigung
- Affinity purified
- Immunogen
- LRRN2 antibody was raised using the middle region of LRRN2 corresponding to a region with amino acids RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
- Top Product
- Discover our top product LRRN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRN2 Blocking Peptide, catalog no. 33R-8253, is also available for use as a blocking control in assays to test for specificity of this LRRN2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRN2 (Leucine Rich Repeat Neuronal 2 (LRRN2))
- Andere Bezeichnung
- LRRN2 (LRRN2 Produkte)
- Synonyme
- GAC1 antikoerper, LRRN5 antikoerper, LRANK1 antikoerper, FIGLER7 antikoerper, LRRN2 antikoerper, leucine rich repeat neuronal 2 antikoerper, LRRN2 antikoerper, Lrrn2 antikoerper
- Hintergrund
- The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas.
- Molekulargewicht
- 79 kDa (MW of target protein)
-