LRRN2 Antikörper (Middle Region)

Produktnummer ABIN635276

Der Kaninchen Polyklonal Anti-LRRN2-Antikörper wurde für WB validiert. Er ist geeignet, LRRN2 in Proben von Human zu detektieren.

Kurzübersicht für LRRN2 Antikörper (Middle Region) (ABIN635276)

Target: LRRN2 (Leucine Rich Repeat Neuronal 2 (LRRN2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRRN2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LRRN2 antibody was raised against the middle region of LRRN2

Aufreinigung: Affinity purified

Immunogen: LRRN2 antibody was raised using the middle region of LRRN2 corresponding to a region with amino acids RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRN2 Blocking Peptide, (ABIN5614591), is also available for use as a blocking control in assays to test for specificity of this LRRN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRN2

Target: LRRN2 (Leucine Rich Repeat Neuronal 2 (LRRN2))

Andere Bezeichnung: LRRN2

Hintergrund: The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas.

Molekulargewicht: 79 kDa (MW of target protein)