IFNGR2 Antikörper

Produktnummer ABIN635275

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch IFNGR2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für IFNGR2 Antikörper (ABIN635275)

Target: IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFNGR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IFNGR2 Antikörper

Aufreinigung: Affinity purified

Immunogen: IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFN Gamma R2 Blocking Peptide, (ABIN5614148), is also available for use as a blocking control in assays to test for specificity of this IFN Gamma R2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNGR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFNGR2

Target: IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))

Andere Bezeichnung: IFN gamma R2

Hintergrund: IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection.

Molekulargewicht: 35 kDa (MW of target protein)