IFNGR2 Antikörper
-
- Target Alle IFNGR2 Antikörper anzeigen
- IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IFNGR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL
- Top Product
- Discover our top product IFNGR2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IFN Gamma R2 Blocking Peptide, catalog no. 33R-9941, is also available for use as a blocking control in assays to test for specificity of this IFN Gamma R2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNGR2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))
- Andere Bezeichnung
- IFN gamma R2 (IFNGR2 Produkte)
- Hintergrund
- IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection.
- Molekulargewicht
- 35 kDa (MW of target protein)
-