SGCE Antikörper (Sarcoglycan, epsilon) (N-Term)

Details for Product anti-SGCE Antibody No. ABIN635274
Antigen
Epitop
N-Term
4
2
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
33
16
11
1
1
1
1
1
1
Wirt
Kaninchen
31
2
Klonalität
Polyklonal
Konjugat
Dieser SGCE Antikörper ist unkonjugiert
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
28
13
9
8
2
1
1
1
1
1
Optionen
Immunogen SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI
Spezifität SGCE antibody was raised against the N terminal of SGCE
Reinigung Affinity purified
Antigen
Andere Bezeichnung SGCE (SGCE Antibody Abstract)
Hintergrund SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix.
Molekulargewicht 52 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SGCE Blocking Peptide, catalog no. 33R-9378, is also available for use as a blocking control in assays to test for specificity of this SGCE antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCE antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.