SGCE Antikörper (N-Term)
-
- Target Alle SGCE Antikörper anzeigen
- SGCE (Sarcoglycan, epsilon (SGCE))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SGCE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SGCE antibody was raised against the N terminal of SGCE
- Aufreinigung
- Affinity purified
- Immunogen
- SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI
- Top Product
- Discover our top product SGCE Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SGCE Blocking Peptide, catalog no. 33R-9378, is also available for use as a blocking control in assays to test for specificity of this SGCE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SGCE (Sarcoglycan, epsilon (SGCE))
- Andere Bezeichnung
- SGCE (SGCE Produkte)
- Synonyme
- scge antikoerper, zgc:92318 antikoerper, DYT11 antikoerper, ESG antikoerper, e-SG antikoerper, sarcoglycan, epsilon antikoerper, sarcoglycan epsilon S homeolog antikoerper, sarcoglycan epsilon antikoerper, sgce antikoerper, sgce.S antikoerper, SGCE antikoerper, Sgce antikoerper
- Hintergrund
- SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix.
- Molekulargewicht
- 52 kDa (MW of target protein)
-