SGCE Antikörper (N-Term)

Produktnummer ABIN635274

Dieses Anti-SGCE-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SGCE in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für SGCE Antikörper (N-Term) (ABIN635274)

Target: SGCE (Sarcoglycan, epsilon (SGCE))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SGCE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SGCE Antikörper

Bindungsspezifität: N-Term

Spezifität: SGCE antibody was raised against the N terminal of SGCE

Aufreinigung: Affinity purified

Immunogen: SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SGCE Blocking Peptide, (ABIN5616112), is also available for use as a blocking control in assays to test for specificity of this SGCE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SGCE

Target: SGCE (Sarcoglycan, epsilon (SGCE))

Andere Bezeichnung: SGCE

Hintergrund: SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix.

Molekulargewicht: 52 kDa (MW of target protein)