Transferrin Receptor 2 Antikörper (Middle Region)
-
- Target Alle Transferrin Receptor 2 (TFR2) Antikörper anzeigen
- Transferrin Receptor 2 (TFR2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Transferrin Receptor 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TFR2 antibody was raised against the middle region of TFR2
- Aufreinigung
- Affinity purified
- Immunogen
- TFR2 antibody was raised using the middle region of TFR2 corresponding to a region with amino acids YVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPNHSGQTLYEQVVFT
- Top Product
- Discover our top product TFR2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TFR2 Blocking Peptide, catalog no. 33R-10285, is also available for use as a blocking control in assays to test for specificity of this TFR2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFR2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Transferrin Receptor 2 (TFR2)
- Andere Bezeichnung
- TFR2 (TFR2 Produkte)
- Hintergrund
- TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III.
- Molekulargewicht
- 89 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-