Transferrin Receptor 2 Antikörper (TFR2) (N-Term)

Details for Product anti-TFR2 Antibody No. ABIN635270
Antigen
Epitop
N-Term
10
8
3
3
2
2
2
2
2
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
44
19
9
4
3
2
2
2
2
2
1
1
Wirt
Kaninchen
54
9
Klonalität
Polyklonal
Konjugat
Dieser Transferrin Receptor 2 Antikörper ist unkonjugiert
8
3
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
57
25
23
12
9
8
5
5
4
4
3
1
Optionen
Immunogen TFR2 antibody was raised using the N terminal of TFR2 corresponding to a region with amino acids RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDP
Spezifität TFR2 antibody was raised against the N terminal of TFR2
Reinigung Affinity purified
Antigen
Andere Bezeichnung TFR2 (TFR2 Antibody Abstract)
Hintergrund TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III.
Molekulargewicht 89 kDa (MW of target protein)
Pathways Transition Metal Ion Homeostasis
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TFR2 Blocking Peptide, catalog no. 33R-7800, is also available for use as a blocking control in assays to test for specificity of this TFR2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFR2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Transferrin Receptor 2 (TFR2) (N-Term) antibody (ABIN635270) TFR2 antibody used at 1 ug/ml to detect target protein.