Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) Antikörper
-
- Target Alle Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) Antikörper anzeigen
- Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC17 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
- Top Product
- Discover our top product SLC17A5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC17A5 Blocking Peptide, catalog no. 33R-4951, is also available for use as a blocking control in assays to test for specificity of this SLC17A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5)
- Andere Bezeichnung
- SLC17A5 (SLC17A5 Produkte)
- Synonyme
- AST antikoerper, ISSD antikoerper, NSD antikoerper, SD antikoerper, SIALIN antikoerper, SIASD antikoerper, SLD antikoerper, sialin antikoerper, got2 antikoerper, zgc:66329 antikoerper, 4631416G20Rik antikoerper, 4732491M05 antikoerper, SP55 antikoerper, sb:cb809 antikoerper, zgc:153077 antikoerper, solute carrier family 17 member 5 antikoerper, solute carrier family 17 member 5 S homeolog antikoerper, glutamic-oxaloacetic transaminase 2a, mitochondrial antikoerper, solute carrier family 17 (anion/sugar transporter), member 5 antikoerper, solute carrier family 17 (acidic sugar transporter), member 5 antikoerper, SLC17A5 antikoerper, slc17a5.S antikoerper, got2a antikoerper, Slc17a5 antikoerper, slc17a5 antikoerper
- Hintergrund
- SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.
- Molekulargewicht
- 55 kDa (MW of target protein)
-