Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) Antikörper
-
- Target Alle Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) Antikörper anzeigen
- Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC17 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC17A5 Blocking Peptide, catalog no. 33R-4951, is also available for use as a blocking control in assays to test for specificity of this SLC17A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5)
- Andere Bezeichnung
- SLC17A5 (SLC17A5 Produkte)
- Hintergrund
- SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.
- Molekulargewicht
- 55 kDa (MW of target protein)
-