Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) Antikörper

Details zu Produkt Nr. ABIN635267
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
24
11
10
2
2
2
2
2
1
1
1
1
1
1
1
Wirt
Kaninchen
18
7
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
1
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
24
17
6
2
1
1
1
1
1
Optionen
Immunogen SLC17 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC17A5 (SLC17A5 Antibody Abstract)
Hintergrund SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.
Molekulargewicht 55 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC17A5 Blocking Peptide, catalog no. 33R-4951, is also available for use as a blocking control in assays to test for specificity of this SLC17A5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) antibody (ABIN635267) SLC17A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to...
Image no. 2 for anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) antibody (ABIN635267) SLC17A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. M...
Image no. 3 for anti-Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) antibody (ABIN635267) SLC17A5 antibody used at 0.5 ug/ml to detect target protein.