SLC45A2 Antikörper (C-Term)

Produktnummer ABIN635265

Produktdetails anti-SLC45A2 Antikörper

Target: SLC45A2 (Solute Carrier Family 45, Member 2 (SLC45A2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC45A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC45 A2 antibody was raised against the C terminal of SLC45 2

Aufreinigung: Affinity purified

Immunogen: SLC45 A2 antibody was raised using the C terminal of SLC45 2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC45A2 Blocking Peptide, catalog no. 33R-3980, is also available for use as a blocking control in assays to test for specificity of this SLC45A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC45A2

Target: SLC45A2 (Solute Carrier Family 45, Member 2 (SLC45A2))

Andere Bezeichnung: SLC45A2 (SLC45A2 Produkte)

Synonyme: SLC45A2 antikoerper, matp antikoerper, aim1 antikoerper, im:7138762 antikoerper, MGC114950 antikoerper, 1A1 antikoerper, AIM1 antikoerper, MATP antikoerper, OCA4 antikoerper, SHEP5 antikoerper, Aim-1 antikoerper, Aim1 antikoerper, Dbr antikoerper, Matp antikoerper, blanc-sale antikoerper, bls antikoerper, uw antikoerper, solute carrier family 45 member 2 antikoerper, solute carrier family 45, member 2 antikoerper, solute carrier family 45 member 2 L homeolog antikoerper, SLC45A2 antikoerper, slc45a2 antikoerper, slc45a2.L antikoerper, Slc45a2 antikoerper

Hintergrund: SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.

Molekulargewicht: 51 kDa (MW of target protein)