Dystroglycan Antikörper

Produktnummer ABIN635261

Der Kaninchen Polyklonal anti-Dystroglycan Antikörper wird verwendet zum Nachweis von Dystroglycan in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Dystroglycan Antikörper (ABIN635261)

Target: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Dystroglycan Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Dystroglycan Antikörper

Aufreinigung: Affinity purified

Immunogen: DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAG1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DAG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Dystroglycan

Target: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Andere Bezeichnung: DAG1

Hintergrund: Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus