Dystroglycan Antikörper

Produktnummer ABIN635261

Produktdetails anti-Dystroglycan Antikörper

Target: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Dystroglycan Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAG1 Blocking Peptide, catalog no. 33R-1265, is also available for use as a blocking control in assays to test for specificity of this DAG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Dystroglycan

Target: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Andere Bezeichnung: DAG1 (DAG1 Produkte)

Synonyme: LOC398500 antikoerper, dag1 antikoerper, MGC53537 antikoerper, 156DAG antikoerper, A3a antikoerper, AGRNR antikoerper, DAG antikoerper, MDDGC7 antikoerper, MDDGC9 antikoerper, DAG1 antikoerper, RAB7 antikoerper, dg antikoerper, a3a antikoerper, dag antikoerper, agrnr antikoerper, 156dag antikoerper, D9Wsu13e antikoerper, DG antikoerper, Dp427 antikoerper, Dp71 antikoerper, CG18250 antikoerper, CT41273 antikoerper, DmDG antikoerper, Dmel\\CG18250 antikoerper, atu antikoerper, dgn antikoerper, dys antikoerper, GB14967 antikoerper, APOJ antikoerper, CLI antikoerper, RATTRPM2B antikoerper, SGP-2 antikoerper, SGP2 antikoerper, SP-40 antikoerper, SP40 antikoerper, TRPM-2 antikoerper, TRPM2B antikoerper, Trpm2 antikoerper, Trpmb antikoerper, Ala-1 antikoerper, H9/25 antikoerper, Ly-27 antikoerper, Ly-6 antikoerper, Ly27 antikoerper, wu:fb83d06 antikoerper, wu:fi25f06 antikoerper, wu:fi37b08 antikoerper, zgc:109786 antikoerper, DystroGlycaN antikoerper, dystroglycan 1 L homeolog antikoerper, dystroglycan 1 antikoerper, dystroglycan 1 S homeolog antikoerper, Dystroglycan antikoerper, dystroglycan antikoerper, clusterin antikoerper, lymphocyte antigen 6 complex antikoerper, dgn-1 antikoerper, dag1.L antikoerper, dgn-2 antikoerper, dgn-3 antikoerper, DAG1 antikoerper, dag1.S antikoerper, Dag1 antikoerper, dag1 antikoerper, Dg antikoerper, LOC408826 antikoerper, Clu antikoerper, Ly6 antikoerper

Hintergrund: Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus