ABCC8 Antikörper (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8)

Details for Product anti-ABCC8 Antibody No. ABIN635259
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
72
41
37
25
2
2
2
2
1
1
1
1
Wirt
Kaninchen
40
33
7
Klonalität
Polyklonal
Konjugat
Dieser ABCC8 Antikörper ist unkonjugiert
5
4
4
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
65
43
30
29
26
5
5
2
1
1
1
1
Optionen
Immunogen ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
Reinigung Affinity purified
Antigen
Andere Bezeichnung ABCC8 (ABCC8 Antibody Abstract)
Hintergrund ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.
Molekulargewicht 177 kDa (MW of target protein)
Pathways Negative Regulation of Hormone Secretion
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ABCC8 Blocking Peptide, catalog no. 33R-7184, is also available for use as a blocking control in assays to test for specificity of this ABCC8 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC8 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.