RNF186 Antikörper (N-Term)

Produktnummer ABIN635255

Produktdetails anti-RNF186 Antikörper

Target: RNF186 (Ring Finger Protein 186 (RNF186))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF186 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF186 antibody was raised against the N terminal of RNF186

Aufreinigung: Affinity purified

Immunogen: RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF186 Blocking Peptide, catalog no. 33R-5617, is also available for use as a blocking control in assays to test for specificity of this RNF186 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF186 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF186

Target: RNF186 (Ring Finger Protein 186 (RNF186))

Andere Bezeichnung: RNF186 (RNF186 Produkte)

Synonyme: RP11-91K11.1 antikoerper, 9130020G10Rik antikoerper, ring finger protein 186 antikoerper, RNF186 antikoerper, Rnf186 antikoerper

Hintergrund: The specific function of RNF186 is not yet known.

Molekulargewicht: 24 kDa (MW of target protein)