RNF186 Antikörper (Ring Finger Protein 186) (N-Term)

Details for Product anti-RNF186 Antibody No. ABIN635255
Antigen
Epitop
N-Term
2
2
2
1
1
1
Reaktivität
Human
28
15
15
1
1
Wirt
Kaninchen
24
4
Klonalität
Polyklonal
Konjugat
Dieser RNF186 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
16
13
8
3
Optionen
Immunogen RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP
Spezifität RNF186 antibody was raised against the N terminal of RNF186
Reinigung Affinity purified
Antigen
Andere Bezeichnung RNF186
Hintergrund The specific function of RNF186 is not yet known.
Molekulargewicht 24 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

RNF186 Blocking Peptide, catalog no. 33R-5617, is also available for use as a blocking control in assays to test for specificity of this RNF186 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF186 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Ring Finger Protein 186 (RNF186) (N-Term) antibody (ABIN635255) RNF186 antibody used at 1 ug/ml to detect target protein.