MUL1 Antikörper (Middle Region)

Produktnummer ABIN635254

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MUL1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für MUL1 Antikörper (Middle Region) (ABIN635254)

Target: MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MUL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MUL1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C1 ORF166 antibody was raised against the middle region of C1 rf166

Aufreinigung: Affinity purified

Immunogen: C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF166 Blocking Peptide, (ABIN939975), is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF166 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MUL1

Target: MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))

Andere Bezeichnung: C1ORF166

Hintergrund: C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity