Tetraspanin 17 (TSPAN17) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635252
Antigen
Epitop
N-Term
3
3
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
10
5
5
4
4
4
4
4
4
2
2
2
2
1
1
1
Wirt
Kaninchen
8
3
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
11
1
Optionen
Immunogen Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI
Spezifität Tetraspanin 17 antibody was raised against the N terminal of TSPAN17
Reinigung Affinity purified
Antigen
Andere Bezeichnung Tetraspanin 17
Hintergrund The function of Tetraspanin 17 protein is not widely studied, and is yet to be elucidated fully.
Molekulargewicht 37 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Tetraspanin 17 Blocking Peptide, catalog no. 33R-3647, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 17 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN17 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Tetraspanin 17 (TSPAN17) (N-Term) antibody (ABIN635252) Tetraspanin 17 antibody used at 1 ug/ml to detect target protein.