Tetraspanin 17 Antikörper (N-Term)

Produktnummer ABIN635252

Der Kaninchen Polyklonal Anti-Tetraspanin 17-Antikörper wurde für WB validiert. Er ist geeignet, Tetraspanin 17 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Tetraspanin 17 Antikörper (N-Term) (ABIN635252)

Target: Tetraspanin 17 (TSPAN17)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tetraspanin 17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Tetraspanin 17 Antikörper

Bindungsspezifität: N-Term

Spezifität: Tetraspanin 17 antibody was raised against the N terminal of TSPAN17

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 17 Blocking Peptide, (ABIN939033), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tetraspanin 17

Target: Tetraspanin 17 (TSPAN17)

Andere Bezeichnung: Tetraspanin 17

Hintergrund: The function of Tetraspanin 17 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 37 kDa (MW of target protein)