MOGAT1 Antikörper (C-Term)

Produktnummer ABIN635250

Produktdetails anti-MOGAT1 Antikörper

Target: MOGAT1 (Monoacylglycerol O-Acyltransferase 1 (MOGAT1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MOGAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MOGAT1 antibody was raised against the C terminal of MOGAT1

Aufreinigung: Affinity purified

Immunogen: MOGAT1 antibody was raised using the C terminal of MOGAT1 corresponding to a region with amino acids PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MOGAT1 Blocking Peptide, catalog no. 33R-7161, is also available for use as a blocking control in assays to test for specificity of this MOGAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOGAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MOGAT1

Target: MOGAT1 (Monoacylglycerol O-Acyltransferase 1 (MOGAT1))

Andere Bezeichnung: MOGAT1 (MOGAT1 Produkte)

Synonyme: DGAT2L antikoerper, DGAT2L1 antikoerper, MGAT1 antikoerper, 0610030A14Rik antikoerper, 1110064N14Rik antikoerper, Dgat2l antikoerper, Dgat2l1 antikoerper, mDC2 antikoerper, mogat2-a antikoerper, dgat2l1 antikoerper, mogat1 antikoerper, monoacylglycerol O-acyltransferase 1 antikoerper, 2-acylglycerol O-acyltransferase 1 antikoerper, monoacylglycerol O-acyltransferase 2, gene 2 L homeolog antikoerper, monoacylglycerol O-acyltransferase 1 L homeolog antikoerper, MOGAT1 antikoerper, mogt1 antikoerper, Mogat1 antikoerper, Tsp_09229 antikoerper, mogat2.2.L antikoerper, mogat1.L antikoerper

Hintergrund: Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.

Molekulargewicht: 39 kDa (MW of target protein)