C19orf46 Antikörper (N-Term)

Produktnummer ABIN635247

Produktdetails anti-C19orf46 Antikörper

Target: C19orf46 (Chromosome 19 Open Reading Frame 46 (C19orf46))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C19orf46 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C19 ORF46 antibody was raised against the N terminal Of C19 rf46

Aufreinigung: Affinity purified

Immunogen: C19 ORF46 antibody was raised using the N terminal Of C19 rf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF46 Blocking Peptide, catalog no. 33R-3224, is also available for use as a blocking control in assays to test for specificity of this C19ORF46 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C19orf46

Target: C19orf46 (Chromosome 19 Open Reading Frame 46 (C19orf46))

Andere Bezeichnung: C19ORF46 (C19orf46 Produkte)

Synonyme: C19orf46 antikoerper, Nesp4 antikoerper, C18H19orf46 antikoerper, 0610012K07Rik antikoerper, AI428936 antikoerper, RGD1304580 antikoerper, C1H19orf46 antikoerper, spectrin repeat containing nuclear envelope family member 4 antikoerper, spectrin repeat containing, nuclear envelope family member 4 antikoerper, SYNE4 antikoerper, Syne4 antikoerper

Hintergrund: C19orf46 contributes to the establishment of secretory epithelial morphology by promoting kinesin-dependent apical migration of the centrosome and Golgi apparatus and basal localization of the nucleus.

Molekulargewicht: 43 kDa (MW of target protein)