AADACL4 Antikörper (N-Term)

Produktnummer ABIN635244

Produktdetails anti-AADACL4 Antikörper

Target: AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AADACL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AADACL4 antibody was raised against the N terminal of AADACL4

Aufreinigung: Affinity purified

Immunogen: AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AADACL4 Blocking Peptide, catalog no. 33R-2935, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AADACL4

Target: AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))

Andere Bezeichnung: AADACL4 (AADACL4 Produkte)

Hintergrund: The function of AADAC protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)