SLC41A3 Antikörper (C-Term)

Produktnummer ABIN635242

Produktdetails anti-SLC41A3 Antikörper

Target: SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC41A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC41 A3 antibody was raised against the C terminal of SLC41 3

Aufreinigung: Affinity purified

Immunogen: SLC41 A3 antibody was raised using the C terminal of SLC41 3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC41A3 Blocking Peptide, catalog no. 33R-9954, is also available for use as a blocking control in assays to test for specificity of this SLC41A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC41A3

Target: SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))

Andere Bezeichnung: SLC41A3 (SLC41A3 Produkte)

Synonyme: slc41a1-l2 antikoerper, slc41a3.2 antikoerper, SLC41A1-L2 antikoerper, 1010001P06Rik antikoerper, AI480742 antikoerper, solute carrier family 41 member 3 antikoerper, solute carrier family 41 member 3 L homeolog antikoerper, solute carrier family 41, member 3 antikoerper, SLC41A3 antikoerper, slc41a3.L antikoerper, Slc41a3 antikoerper

Hintergrund: SLC41A3 is a multi-pass membrane protein. It belongs to the SLC41A transporter family. The exact function of SLC41A3 remains unknown.

Molekulargewicht: 55 kDa (MW of target protein)