RNF182 Antikörper (Middle Region)

Produktnummer ABIN635241

Produktdetails anti-RNF182 Antikörper

Target: RNF182 (Ring Finger Protein 182 (RNF182))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF182 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF182 antibody was raised against the middle region of RNF182

Aufreinigung: Affinity purified

Immunogen: RNF182 antibody was raised using the middle region of RNF182 corresponding to a region with amino acids LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF182 Blocking Peptide, catalog no. 33R-5457, is also available for use as a blocking control in assays to test for specificity of this RNF182 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF182 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF182

Target: RNF182 (Ring Finger Protein 182 (RNF182))

Andere Bezeichnung: RNF182 (RNF182 Produkte)

Hintergrund: RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.

Molekulargewicht: 27 kDa (MW of target protein)