RNF182 Antikörper (Ring Finger Protein 182) (Middle Region)

Details for Product anti-RNF182 Antibody No. ABIN635241
Antigen
Epitop
Middle Region
14
9
4
2
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
28
6
6
4
4
4
3
3
2
2
2
1
1
Wirt
Kaninchen
24
4
Klonalität
Polyklonal
Konjugat
Dieser RNF182 Antikörper ist unkonjugiert
3
3
3
2
2
2
Applikation
Western Blotting (WB)
24
23
1
1
Optionen
Immunogen RNF182 antibody was raised using the middle region of RNF182 corresponding to a region with amino acids LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY
Spezifität RNF182 antibody was raised against the middle region of RNF182
Reinigung Affinity purified
Antigen
Andere Bezeichnung RNF182 (RNF182 Antibody Abstract)
Hintergrund RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.
Molekulargewicht 27 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

RNF182 Blocking Peptide, catalog no. 33R-5457, is also available for use as a blocking control in assays to test for specificity of this RNF182 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF182 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Ring Finger Protein 182 (RNF182) (Middle Region) antibody (ABIN635241) RNF182 antibody used at 1 ug/ml to detect target protein.