RNF139 Antikörper (N-Term)

Produktnummer ABIN635236

Produktdetails anti-RNF139 Antikörper

Target: RNF139 (Ring Finger Protein 139 (RNF139))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF139 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF139 antibody was raised against the N terminal of RNF139

Aufreinigung: Affinity purified

Immunogen: RNF139 antibody was raised using the N terminal of RNF139 corresponding to a region with amino acids SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF139 Blocking Peptide, catalog no. 33R-8723, is also available for use as a blocking control in assays to test for specificity of this RNF139 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF139 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF139

Target: RNF139 (Ring Finger Protein 139 (RNF139))

Andere Bezeichnung: RNF139 (RNF139 Produkte)

Synonyme: HRCA1 antikoerper, RCA1 antikoerper, TRC8 antikoerper, 4930555P18Rik antikoerper, zgc:175173 antikoerper, rnf139 antikoerper, ring finger protein 139 antikoerper, ring finger protein 139 S homeolog antikoerper, RNF139 antikoerper, Rnf139 antikoerper, rnf139 antikoerper, rnf139.S antikoerper

Hintergrund: RNF139 is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP.

Molekulargewicht: 76 kDa (MW of target protein)