beta-Site APP-Cleaving Enzyme 2 (BACE2) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635235
Antigen
Epitop
N-Term
20
15
15
10
10
8
7
7
4
4
4
4
3
2
2
1
1
1
1
1
1
1
1
Reaktivität
Human
122
51
45
4
3
2
2
2
2
1
1
1
1
Wirt
Kaninchen
130
2
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
12
9
4
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
114
58
43
19
18
13
7
4
4
3
2
Optionen
Immunogen BACE2 antibody was raised using the N terminal of BACE2 corresponding to a region with amino acids PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
Spezifität BACE2 antibody was raised against the N terminal of BACE2
Reinigung Affinity purified
Antigen
Andere Bezeichnung BACE2 (BACE2 Antibody Abstract)
Hintergrund Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
Molekulargewicht 37 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

BACE2 Blocking Peptide, catalog no. 33R-6958, is also available for use as a blocking control in assays to test for specificity of this BACE2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-beta-Site APP-Cleaving Enzyme 2 (BACE2) (N-Term) antibody (ABIN635235) BACE2 antibody used at 1 ug/ml to detect target protein.