VNN3 Antikörper (N-Term)

Produktnummer ABIN635233

Produktdetails anti-VNN3 Antikörper

Target: VNN3 (Vanin 3 (VNN3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VNN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VNN3 antibody was raised against the N terminal of VNN3

Aufreinigung: Affinity purified

Immunogen: VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VNN3 Blocking Peptide, catalog no. 33R-9602, is also available for use as a blocking control in assays to test for specificity of this VNN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VNN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VNN3

Target: VNN3 (Vanin 3 (VNN3))

Andere Bezeichnung: VNN3 (VNN3 Produkte)

Synonyme: HSA238982 antikoerper, foap-4 antikoerper, gpi-80 antikoerper, hdlcq8 antikoerper, tiff66 antikoerper, vnn1.2 antikoerper, vnn3 antikoerper, RGD1560609 antikoerper, VNN3 antikoerper, vanin 3 antikoerper, vanin 2 antikoerper, vascular non-inflammatory molecule 3-like antikoerper, vascular non-inflammatory molecule 3 antikoerper, VNN3 antikoerper, Vnn3 antikoerper, vnn2 antikoerper, LOC708748 antikoerper, LOC100067649 antikoerper

Hintergrund: This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described, the two most common variants are represented as RefSeqs.

Molekulargewicht: 28 kDa (MW of target protein)