VNN3 Antikörper (N-Term)

Produktnummer ABIN635233

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch VNN3 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für VNN3 Antikörper (N-Term) (ABIN635233)

Target: VNN3 (Vanin 3 (VNN3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VNN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VNN3 Antikörper

Bindungsspezifität: N-Term

Spezifität: VNN3 antibody was raised against the N terminal of VNN3

Aufreinigung: Affinity purified

Immunogen: VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VNN3 Blocking Peptide, (ABIN5616971), is also available for use as a blocking control in assays to test for specificity of this VNN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VNN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VNN3

Target: VNN3 (Vanin 3 (VNN3))

Andere Bezeichnung: VNN3

Hintergrund: This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described, the two most common variants are represented as RefSeqs.

Molekulargewicht: 28 kDa (MW of target protein)