LRRC66 Antikörper (Middle Region)

Produktnummer ABIN635232

Dieses Anti-LRRC66-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von LRRC66 in WB. Geeignet für Human.

Kurzübersicht für LRRC66 Antikörper (Middle Region) (ABIN635232)

Target: LRRC66 (Leucine Rich Repeat Containing 66 (LRRC66))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC66 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRRC66 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LRRC66 antibody was raised against the middle region of LRRC66

Aufreinigung: Affinity purified

Immunogen: LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC66 Blocking Peptide, (ABIN5614586), is also available for use as a blocking control in assays to test for specificity of this LRRC66 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC66 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC66

Target: LRRC66 (Leucine Rich Repeat Containing 66 (LRRC66))

Andere Bezeichnung: LRRC66

Hintergrund: The function of LOC339977 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 98 kDa (MW of target protein)