SLC35D3 Antikörper (N-Term)

Produktnummer ABIN635225

Produktdetails anti-SLC35D3 Antikörper

Target: SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35D3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC35 D3 antibody was raised against the N terminal of SLC35 3

Aufreinigung: Affinity purified

Immunogen: SLC35 D3 antibody was raised using the N terminal of SLC35 3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35D3 Blocking Peptide, catalog no. 33R-8281, is also available for use as a blocking control in assays to test for specificity of this SLC35D3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35D3

Target: SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))

Andere Bezeichnung: SLC35D3 (SLC35D3 Produkte)

Synonyme: FRCL1 antikoerper, bA55K22.3 antikoerper, 6230421J19Rik antikoerper, Frcl1 antikoerper, solute carrier family 35, member D3 antikoerper, solute carrier family 35 member D3 antikoerper, Slc35d3 antikoerper, SLC35D3 antikoerper, slc35d3 antikoerper

Hintergrund: SLC35D3 may play a role in hemostasis as a regulator of the biosynthesis of platelet-dense granules.

Molekulargewicht: 44 kDa (MW of target protein)