SLC35D3 Antikörper (N-Term)

Produktnummer ABIN635225

Der Kaninchen Polyklonal Anti-SLC35D3-Antikörper wurde für WB validiert. Er ist geeignet, SLC35D3 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für SLC35D3 Antikörper (N-Term) (ABIN635225)

Target: SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35D3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC35D3 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLC35 D3 antibody was raised against the N terminal of SLC35 3

Aufreinigung: Affinity purified

Immunogen: SLC35 D3 antibody was raised using the N terminal of SLC35 3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35D3 Blocking Peptide, (ABIN5616238), is also available for use as a blocking control in assays to test for specificity of this SLC35D3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35D3

Target: SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))

Andere Bezeichnung: SLC35D3

Hintergrund: SLC35D3 may play a role in hemostasis as a regulator of the biosynthesis of platelet-dense granules.

Molekulargewicht: 44 kDa (MW of target protein)