Fc epsilon RI/FCER1A Antikörper (N-Term)

Produktnummer ABIN635223

Dieses Anti-Fc epsilon RI/FCER1A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Fc epsilon RI/FCER1A in WB. Geeignet für Human.

Kurzübersicht für Fc epsilon RI/FCER1A Antikörper (N-Term) (ABIN635223)

Target: Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Fc epsilon RI/FCER1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Fc epsilon RI/FCER1A Antikörper

Bindungsspezifität: N-Term

Spezifität: FCER1 A antibody was raised against the N terminal of FCER1

Aufreinigung: Affinity purified

Immunogen: FCER1 A antibody was raised using the N terminal of FCER1 corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FCER1A Blocking Peptide, ABIN5613559, is also available for use as a blocking control in assays to test for specificity of this FCER1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCER0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Fc epsilon RI/FCER1A

Target: Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))

Andere Bezeichnung: FCER1A

Hintergrund: The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process