Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635220
Antigen
Epitop
N-Term
3
2
1
1
1
1
Reaktivität
Human
20
14
12
4
3
3
2
2
2
1
Wirt
Kaninchen
16
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
15
8
4
2
1
Optionen
Immunogen PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS
Spezifität PIGQ antibody was raised against the N terminal of PIGQ
Reinigung Affinity purified
Antigen
Andere Bezeichnung PIGQ (PIGQ Antibody Abstract)
Hintergrund PIGQ is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGQ is a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).
Molekulargewicht 65 kDa (MW of target protein)
Pathways Inositol Metabolic Process
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PIGQ Blocking Peptide, catalog no. 33R-7400, is also available for use as a blocking control in assays to test for specificity of this PIGQ antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGQ antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ) (N-Term) antibody (ABIN635220) PIGQ antibody used at 1 ug/ml to detect target protein.