C-Type Lectin Domain Family 6, Member A (CLEC6A) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635219
Antigen
Epitop
N-Term
13
10
9
8
4
3
3
2
2
2
1
1
1
Reaktivität
Human
72
40
21
1
Wirt
Kaninchen
63
11
10
3
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
6
5
5
4
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
46
28
24
20
13
8
6
3
2
1
Optionen
Immunogen CLEC6 A antibody was raised using the N terminal of CLEC6 corresponding to a region with amino acids FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK
Spezifität CLEC6 A antibody was raised against the N terminal of CLEC6
Reinigung Affinity purified
Antigen
Andere Bezeichnung CLEC6A (CLEC6A Antibody Abstract)
Hintergrund CLEC6A may be involved in regulating immune reactivity.
Molekulargewicht 24 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

CLEC6A Blocking Peptide, catalog no. 33R-2939, is also available for use as a blocking control in assays to test for specificity of this CLEC6A antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-C-Type Lectin Domain Family 6, Member A (CLEC6A) (N-Term) antibody (ABIN635219) CLEC6A antibody used at 1 ug/ml to detect target protein.