C-Type Lectin Domain Family 6, Member A (CLEC6A) (N-Term) Antikörper

Produktnummer ABIN635219

Produktdetails

Target: C-Type Lectin Domain Family 6, Member A (CLEC6A)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CLEC6 A antibody was raised against the N terminal of CLEC6

Aufreinigung: Affinity purified

Immunogen: CLEC6 A antibody was raised using the N terminal of CLEC6 corresponding to a region with amino acids FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLEC6A Blocking Peptide, catalog no. 33R-2939, is also available for use as a blocking control in assays to test for specificity of this CLEC6A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: C-Type Lectin Domain Family 6, Member A (CLEC6A)

Andere Bezeichnung: CLEC6A (CLEC6A Produkte)

Synonyme: CLEC4N antikoerper, CLECSF10 antikoerper, CLEC6A antikoerper, C-type lectin domain containing 6A antikoerper, C-type lectin domain family 6, member A antikoerper, CLEC6A antikoerper, Clec6a antikoerper

Hintergrund: CLEC6A may be involved in regulating immune reactivity.

Molekulargewicht: 24 kDa (MW of target protein)