Transmembrane Protein 93 (TMEM93) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635215
Antigen
Epitop
N-Term
4
2
Reaktivität
Human, Maus, Ratte (Rattus)
8
3
3
2
2
2
2
2
1
1
1
Wirt
Kaninchen
8
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
5
3
1
1
1
1
Optionen
Immunogen TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
Spezifität TMEM93 antibody was raised against the N terminal of TMEM93
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM93
Hintergrund TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.
Molekulargewicht 12 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM93 Blocking Peptide, catalog no. 33R-1062, is also available for use as a blocking control in assays to test for specificity of this TMEM93 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM93 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Transmembrane Protein 93 (TMEM93) (N-Term) antibody (ABIN635215) TMEM93 antibody used at 1 ug/ml to detect target protein.