TMEM93 Antikörper (N-Term)
Kurzübersicht für TMEM93 Antikörper (N-Term) (ABIN635215)
Target
Reaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- TMEM93 antibody was raised against the N terminal of TMEM93
-
Aufreinigung
- Affinity purified
-
Immunogen
- TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
TMEM93 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM93 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM93 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- TMEM93 (Transmembrane Protein 93 (TMEM93))
-
Andere Bezeichnung
- TMEM93
-
Hintergrund
- TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.
-
Molekulargewicht
- 12 kDa (MW of target protein)
Target
-