Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

TMEM93 Antikörper (N-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TMEM93 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.
Produktnummer ABIN635215

Kurzübersicht für TMEM93 Antikörper (N-Term) (ABIN635215)

Target

TMEM93 (Transmembrane Protein 93 (TMEM93))

Reaktivität

  • 11
  • 4
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 11
Kaninchen

Klonalität

  • 11
Polyklonal

Konjugat

  • 7
  • 2
  • 1
  • 1
Dieser TMEM93 Antikörper ist unkonjugiert

Applikation

  • 8
  • 4
  • 3
  • 2
Western Blotting (WB)
  • Bindungsspezifität

    • 6
    • 2
    • 1
    N-Term

    Spezifität

    TMEM93 antibody was raised against the N terminal of TMEM93

    Aufreinigung

    Affinity purified

    Immunogen

    TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    TMEM93 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM93 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM93 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    TMEM93 (Transmembrane Protein 93 (TMEM93))

    Andere Bezeichnung

    TMEM93

    Hintergrund

    TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.

    Molekulargewicht

    12 kDa (MW of target protein)
Sie sind hier:
Chat with us!