SFXN3 Antikörper (Middle Region)
-
- Target Alle SFXN3 Antikörper anzeigen
- SFXN3 (Sideroflexin 3 (SFXN3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SFXN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Sideroflexin 3 antibody was raised against the middle region of SFXN3
- Aufreinigung
- Affinity purified
- Immunogen
- Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN
- Top Product
- Discover our top product SFXN3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Sideroflexin 3 Blocking Peptide, catalog no. 33R-9223, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFXN3 (Sideroflexin 3 (SFXN3))
- Andere Bezeichnung
- Sideroflexin 3 (SFXN3 Produkte)
- Synonyme
- xm278 antikoerper, BA108L7.2 antikoerper, SFX3 antikoerper, TCC antikoerper, sideroflexin 3 L homeolog antikoerper, sideroflexin 3 antikoerper, sfxn3.L antikoerper, SFXN3 antikoerper, Sfxn3 antikoerper
- Hintergrund
- SFXN3 is a potential iron transporter.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-