SFXN3 Antikörper (Middle Region)

Produktnummer ABIN635208

Der Kaninchen Polyklonal anti-SFXN3 Antikörper (ABIN635208) detektiert spezifisch SFXN3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für SFXN3 Antikörper (Middle Region) (ABIN635208)

Target: SFXN3 (Sideroflexin 3 (SFXN3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFXN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SFXN3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Sideroflexin 3 antibody was raised against the middle region of SFXN3

Aufreinigung: Affinity purified

Immunogen: Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Sideroflexin 3 Blocking Peptide, (ABIN5616140), is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFXN3

Target: SFXN3 (Sideroflexin 3 (SFXN3))

Andere Bezeichnung: Sideroflexin 3

Hintergrund: SFXN3 is a potential iron transporter.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis