RHBDF1 Antikörper

Produktnummer ABIN635205

Dieses Anti-RHBDF1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RHBDF1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für RHBDF1 Antikörper (ABIN635205)

Target: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHBDF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RHBDF1 Antikörper

Aufreinigung: Affinity purified

Immunogen: RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHBDF1 Blocking Peptide, (ABIN939696), is also available for use as a blocking control in assays to test for specificity of this RHBDF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHBDF1

Target: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Andere Bezeichnung: RHBDF1

Hintergrund: RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Growth Factor Binding