Mannosyl-Oligosaccharide Glucosidase (MOGS) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635202
Antigen
Epitop
N-Term
9
9
9
8
1
1
Reaktivität
Human, Maus
69
38
23
2
2
2
2
2
2
1
1
1
Wirt
Kaninchen
70
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
5
5
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
58
35
13
4
3
2
2
2
Optionen
Immunogen GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ
Spezifität GCS1 antibody was raised against the N terminal of GCS1
Reinigung Affinity purified
Antigen
Andere Bezeichnung GCS1 (MOGS Antibody Abstract)
Hintergrund GCS1 is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum.
Molekulargewicht 92 kDa (MW of target protein)
Pathways SARS-CoV-2 Protein Interaktom
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

GCS1 Blocking Peptide, catalog no. 33R-3486, is also available for use as a blocking control in assays to test for specificity of this GCS1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCS1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Mannosyl-Oligosaccharide Glucosidase (MOGS) (N-Term) antibody (ABIN635202) GCS1 antibody used at 1 ug/ml to detect target protein.