GCS1 Antikörper (N-Term)

Produktnummer ABIN635202

Der Kaninchen Polyklonal anti-GCS1 Antikörper (ABIN635202) detektiert spezifisch GCS1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für GCS1 Antikörper (N-Term) (ABIN635202)

Target: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GCS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GCS1 Antikörper

Bindungsspezifität: N-Term

Spezifität: GCS1 antibody was raised against the N terminal of GCS1

Aufreinigung: Affinity purified

Immunogen: GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GCS1 Blocking Peptide, (ABIN938872), is also available for use as a blocking control in assays to test for specificity of this GCS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GCS1

Target: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Andere Bezeichnung: GCS1

Hintergrund: GCS1 is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom