IL18R1 Antikörper (N-Term)
-
- Target Alle IL18R1 Antikörper anzeigen
- IL18R1 (Interleukin 18 Receptor 1 (IL18R1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL18R1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL18 R1 antibody was raised against the N terminal of IL18 1
- Aufreinigung
- Affinity purified
- Immunogen
- IL18 R1 antibody was raised using the N terminal of IL18 1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE
- Top Product
- Discover our top product IL18R1 Primärantikörper
-
anti-Interleukin 18 Receptor 1 (IL18R1) (AA 19-320) antibody
IL18R1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 18 Receptor 1 (IL18R1) (AA 375-428) antibodyIL18R1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C2 unconjugated
anti-Interleukin 18 Receptor 1 (IL18R1) (AA 22-185) antibodyIL18R1 Reaktivität: Human WB, IHC, ELISA, FACS, ICC, Neut Wirt: Maus Monoclonal 2B7E6 unconjugated
anti-Interleukin 18 Receptor 1 (IL18R1) antibodyIL18R1 Reaktivität: Human WB, FACS, IP, IHC (p), IHC (fro) Wirt: Maus Monoclonal H44 unconjugated
anti-Interleukin 18 Receptor 1 (IL18R1) (AA 22-128) antibodyIL18R1 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 18 Receptor 1 (IL18R1) (AA 391-518) antibodyIL18R1 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 18 Receptor 1 (IL18R1) antibodyIL18R1 Reaktivität: Human IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 18 Receptor 1 (IL18R1) (AA 1-541) antibodyIL18R1 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 18 Receptor 1 (IL18R1) (AA 1-541) antibodyIL18R1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Interleukin 18 Receptor 1 (IL18R1) (Internal Region) antibodyIL18R1 Reaktivität: Human WB, ELISA, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL18R1 Blocking Peptide, catalog no. 33R-7090, is also available for use as a blocking control in assays to test for specificity of this IL18R1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL18R1 (Interleukin 18 Receptor 1 (IL18R1))
- Andere Bezeichnung
- IL18R1 (IL18R1 Produkte)
- Synonyme
- CD218a antikoerper, CDw218a antikoerper, IL-1Rrp antikoerper, IL18RA antikoerper, IL1RRP antikoerper, IL-1R9 antikoerper, IL1R9 antikoerper, IL1RAPL-2 antikoerper, TIGIRR-1 antikoerper, Il18ralpha antikoerper, Il1rrp antikoerper, IL-18Ra antikoerper, IL18R1 antikoerper, interleukin 18 receptor 1 antikoerper, interleukin 1 receptor accessory protein like 2 antikoerper, IL18R1 antikoerper, IL1RAPL2 antikoerper, Il18r1 antikoerper
- Hintergrund
- The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction.
- Molekulargewicht
- 60 kDa (MW of target protein)
-
