IL18R1 Antikörper (N-Term)

Produktnummer ABIN635200

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch IL18R1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für IL18R1 Antikörper (N-Term) (ABIN635200)

Target: IL18R1 (Interleukin 18 Receptor 1 (IL18R1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL18R1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL18R1 Antikörper

Bindungsspezifität: N-Term

Spezifität: IL18 R1 antibody was raised against the N terminal of IL18 1

Aufreinigung: Affinity purified

Immunogen: IL18 R1 antibody was raised using the N terminal of IL18 1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL18R1 Blocking Peptide, (ABIN5614171), is also available for use as a blocking control in assays to test for specificity of this IL18R1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL18R1

Target: IL18R1 (Interleukin 18 Receptor 1 (IL18R1))

Andere Bezeichnung: IL18R1

Hintergrund: The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction.

Molekulargewicht: 60 kDa (MW of target protein)