DLG2 Antikörper

Produktnummer ABIN635193

Produktdetails anti-DLG2 Antikörper

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DLG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLG2 Blocking Peptide, catalog no. 33R-5991, is also available for use as a blocking control in assays to test for specificity of this DLG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLG2

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Andere Bezeichnung: DLG2 (DLG2 Produkte)

Synonyme: PPP1R58 antikoerper, PSD-93 antikoerper, PSD93 antikoerper, chapsyn-110 antikoerper, A330103J02Rik antikoerper, B230218P12Rik antikoerper, B330007M19Rik antikoerper, Dlgh2 antikoerper, Gm1197 antikoerper, discs, large homolog 2 (Drosophila) antikoerper, discs large MAGUK scaffold protein 2 antikoerper, dlg2 antikoerper, DLG2 antikoerper, Dlg2 antikoerper

Hintergrund: DLG2 is a member of the membrane-associated guanylate kinase (MAGUK) family. The protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins.

Molekulargewicht: 97 kDa (MW of target protein)