Calsyntenin 3 Antikörper (N-Term)

Produktnummer ABIN635191

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Calsyntenin 3 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Calsyntenin 3 Antikörper (N-Term) (ABIN635191)

Target: Calsyntenin 3 (CLSTN3)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Calsyntenin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Calsyntenin 3 Antikörper

Bindungsspezifität: N-Term

Spezifität: Calsyntenin 3 antibody was raised against the N terminal of CLSTN3

Aufreinigung: Affinity purified

Immunogen: Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calsyntenin 3 Blocking Peptide, (ABIN5612592), is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Calsyntenin 3

Target: Calsyntenin 3 (CLSTN3)

Andere Bezeichnung: Calsyntenin 3

Hintergrund: CLSTN3 may modulate calcium-mediated postsynaptic signals. Complex formation with APBA2 and APP,CLSTN3 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.

Molekulargewicht: 106 kDa (MW of target protein)