STRA6 Antikörper (Stimulated By Retinoic Acid 6)

Details for Product anti-STRA6 Antibody No. ABIN635189
Antigen
Reaktivität
Human
56
41
20
5
1
Wirt
Kaninchen
66
8
2
Klonalität
Polyklonal
Konjugat
Dieser STRA6 Antikörper ist unkonjugiert
8
7
5
3
3
3
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
48
39
13
9
6
3
2
1
1
1
Optionen
Immunogen STRA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG
Reinigung Affinity purified
Antigen
Andere Bezeichnung STRA6 (STRA6 Antibody Abstract)
Hintergrund STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex.
Molekulargewicht 73 kDa (MW of target protein)
Pathways Feeding Behaviour
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

STRA6 Blocking Peptide, catalog no. 33R-6506, is also available for use as a blocking control in assays to test for specificity of this STRA6 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRA6 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Stimulated By Retinoic Acid 6 (STRA6) antibody (ABIN635189) STRA6 antibody used at 1 ug/ml to detect target protein.