STRA6 Antikörper
-
- Target Alle STRA6 Antikörper anzeigen
- STRA6 (Stimulated By Retinoic Acid 6 (STRA6))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STRA6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- STRA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG
- Top Product
- Discover our top product STRA6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STRA6 Blocking Peptide, catalog no. 33R-6506, is also available for use as a blocking control in assays to test for specificity of this STRA6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRA6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STRA6 (Stimulated By Retinoic Acid 6 (STRA6))
- Andere Bezeichnung
- STRA6 (STRA6 Produkte)
- Hintergrund
- STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex.
- Molekulargewicht
- 73 kDa (MW of target protein)
- Pathways
- Feeding Behaviour
-