STRA6 Antikörper

Produktnummer ABIN635189

Der Kaninchen Polyklonal anti-STRA6 Antikörper wird verwendet zum Nachweis von STRA6 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für STRA6 Antikörper (ABIN635189)

Target: STRA6 (Stimulated By Retinoic Acid 6 (STRA6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STRA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-STRA6 Antikörper

Aufreinigung: Affinity purified

Immunogen: STRA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STRA6 Blocking Peptide, (ABIN5616446), is also available for use as a blocking control in assays to test for specificity of this STRA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STRA6

Target: STRA6 (Stimulated By Retinoic Acid 6 (STRA6))

Andere Bezeichnung: STRA6

Hintergrund: STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Feeding Behaviour